Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (2 families) |
Family d.42.1.1: BTB/POZ domain [54696] (5 proteins) |
Protein Cyclin A/CDK2-associated p45, Skp1 [54710] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [54711] (5 PDB entries) |
Domain d1ldkd2: 1ldk D:2002-2062 [73856] Other proteins in same PDB: d1ldka_, d1ldkb1, d1ldkb2, d1ldkc_, d1ldkd1, d1ldke1 |
PDB Entry: 1ldk (more details), 3.1 Å
SCOP Domain Sequences for d1ldkd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ldkd2 d.42.1.1 (D:2002-2062) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens)} psiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhkd d
Timeline for d1ldkd2: