SCOP 1.67: Domain d1ldkd2: 1ldk D:2002-2062

Lineage for d1ldkd2 (1ldk D:2002-2062)

Root: SCOP 1.67
Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
Fold d.42: POZ domain [54694] (1 superfamily)
core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
Superfamily d.42.1: POZ domain [54695] (2 families)
Family d.42.1.1: BTB/POZ domain [54696] (5 proteins)
Protein Cyclin A/CDK2-associated p45, Skp1 [54710] (1 species)
Species Human (Homo sapiens) [TaxId:9606] [54711] (5 PDB entries)
Domain d1ldkd2: 1ldk D:2002-2062 [73856]
Other proteins in same PDB: d1ldka_, d1ldkb1, d1ldkb2, d1ldkc_, d1ldkd1, d1ldke1
complexed with zn

Details for d1ldkd2

PDB Entry: 1ldk (more details), 3.1 Å

PDB Description: structure of the cul1-rbx1-skp1-f boxskp2 scf ubiquitin ligase complex

SCOP Domain Sequences for d1ldkd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ldkd2 d.42.1.1 (D:2002-2062) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens)}
psiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhkd
d

SCOP Domain Coordinates for d1ldkd2:

Click to download the PDB-style file with coordinates for d1ldkd2.
(The format of our PDB-style files is described here.)

Timeline for d1ldkd2: