Lineage for d1ldkd1 (1ldk D:2084-2140)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2017816Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
    multihelical; interlocked heterodimer with F-box proteins
  4. 2017817Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families) (S)
    automatically mapped to Pfam PF01466
  5. 2017818Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins)
  6. 2017825Protein Cyclin A/CDK2-associated p45, Skp1 [81378] (1 species)
  7. 2017826Species Human (Homo sapiens) [TaxId:9606] [81376] (9 PDB entries)
  8. 2017844Domain d1ldkd1: 1ldk D:2084-2140 [73855]
    Other proteins in same PDB: d1ldka_, d1ldkb1, d1ldkb2, d1ldkc_, d1ldkd2, d1ldke1
    complexed with zn

Details for d1ldkd1

PDB Entry: 1ldk (more details), 3.1 Å

PDB Description: structure of the cul1-rbx1-skp1-f boxskp2 scf ubiquitin ligase complex
PDB Compounds: (D:) cyclin a/cdk2-associated protein p19

SCOPe Domain Sequences for d1ldkd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ldkd1 a.157.1.1 (D:2084-2140) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]}
dipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfn

SCOPe Domain Coordinates for d1ldkd1:

Click to download the PDB-style file with coordinates for d1ldkd1.
(The format of our PDB-style files is described here.)

Timeline for d1ldkd1: