SCOPe 2.01: Domain d1ldkd1: 1ldk D:2084-2140

Lineage for d1ldkd1 (1ldk D:2084-2140)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
   multihelical; interlocked heterodimer with F-box proteins

4. Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (1 family)

5. Family a.157.1.1: Skp1 dimerisation domain-like [81380] (2 proteins)

6. Protein Cyclin A/CDK2-associated p45, Skp1 [81378] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [81376] (8 PDB entries)

8. Domain d1ldkd1: 1ldk D:2084-2140 [73855]
   Other proteins in same PDB: d1ldka_, d1ldkb1, d1ldkb2, d1ldkc_, d1ldkd2, d1ldke1
   complexed with zn

Details for d1ldkd1

PDB Entry: 1ldk, 3.1 Å

PDB Description: structure of the cul1-rbx1-skp1-f boxskp2 scf ubiquitin ligase complex

PDB Compounds: (D:) cyclin a/cdk2-associated protein p19

SCOPe Domain Sequences for d1ldkd1:

Sequence; same for both SEQRES and ATOM records:

>d1ldkd1 a.157.1.1 (D:2084-2140) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]}
dipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfn

Timeline for d1ldkd1:

• d1ldkd1 first appeared in SCOP 1.61
  
• d1ldkd1 appears in SCOP 1.75
  
• d1ldkd1 appears in SCOPe 2.02
  
• d1ldkd1 appears in the current release, SCOPe 2.08