Lineage for d1ldkd1 (1ldk D:2084-2140)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 545442Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
    multihelical; interlocked heterodimer with F-box proteins
  4. 545443Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (1 family) (S)
  5. 545444Family a.157.1.1: Skp1 dimerisation domain-like [81380] (2 proteins)
  6. 545449Protein Cyclin A/CDK2-associated p45, Skp1 [81378] (1 species)
  7. 545450Species Human (Homo sapiens) [TaxId:9606] [81376] (5 PDB entries)
  8. 545464Domain d1ldkd1: 1ldk D:2084-2140 [73855]
    Other proteins in same PDB: d1ldka_, d1ldkb1, d1ldkb2, d1ldkc_, d1ldkd2, d1ldke1
    complexed with zn

Details for d1ldkd1

PDB Entry: 1ldk (more details), 3.1 Å

PDB Description: structure of the cul1-rbx1-skp1-f boxskp2 scf ubiquitin ligase complex

SCOP Domain Sequences for d1ldkd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ldkd1 a.157.1.1 (D:2084-2140) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens)}
dipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfn

SCOP Domain Coordinates for d1ldkd1:

Click to download the PDB-style file with coordinates for d1ldkd1.
(The format of our PDB-style files is described here.)

Timeline for d1ldkd1: