Lineage for d1ldkd1 (1ldk D:2084-2140)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 156209Fold a.122: Skp1-Skp2 dimerisation domains [48502] (1 superfamily)
  4. 156210Superfamily a.122.1: Skp1-Skp2 dimerisation domains [48503] (1 family) (S)
  5. 156211Family a.122.1.1: Skp1-Skp2 dimerisation domains [48504] (1 protein)
  6. 156212Protein Skp1-Skp2 dimerisation domains [48505] (1 species)
  7. 156213Species Human (Homo sapiens) [TaxId:9606] [48506] (4 PDB entries)
  8. 156238Domain d1ldkd1: 1ldk D:2084-2140 [73855]
    Other proteins in same PDB: d1ldka_, d1ldkb1, d1ldkb2, d1ldkc_, d1ldkd2

Details for d1ldkd1

PDB Entry: 1ldk (more details), 3.1 Å

PDB Description: structure of the cul1-rbx1-skp1-f boxskp2 scf ubiquitin ligase complex

SCOP Domain Sequences for d1ldkd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ldkd1 a.122.1.1 (D:2084-2140) Skp1-Skp2 dimerisation domains {Human (Homo sapiens)}
dipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfn

SCOP Domain Coordinates for d1ldkd1:

Click to download the PDB-style file with coordinates for d1ldkd1.
(The format of our PDB-style files is described here.)

Timeline for d1ldkd1: