Lineage for d1ldkc_ (1ldk C:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1066942Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 1066943Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 1066944Family g.44.1.1: RING finger domain, C3HC4 [57851] (14 proteins)
  6. 1066976Protein RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex [75693] (1 species)
  7. 1066977Species Human (Homo sapiens) [TaxId:9606] [75694] (6 PDB entries)
    Uniprot P62877 19-106
  8. 1066984Domain d1ldkc_: 1ldk C: [73854]
    Other proteins in same PDB: d1ldka_, d1ldkb1, d1ldkb2, d1ldkd1, d1ldkd2, d1ldke1
    complexed with zn

Details for d1ldkc_

PDB Entry: 1ldk (more details), 3.1 Å

PDB Description: structure of the cul1-rbx1-skp1-f boxskp2 scf ubiquitin ligase complex
PDB Compounds: (C:) RING-box protein 1

SCOPe Domain Sequences for d1ldkc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ldkc_ g.44.1.1 (C:) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]}
kkrfevkkwnavalwawdivvdncaicrnhimdlciecqanqasatseectvawgvcnha
fhfhcisrwlktrqvcpldnrewefqky

SCOPe Domain Coordinates for d1ldkc_:

Click to download the PDB-style file with coordinates for d1ldkc_.
(The format of our PDB-style files is described here.)

Timeline for d1ldkc_: