SCOPe 2.08: Domain d1ldkb2: 1ldk B:411-686

Lineage for d1ldkb2 (1ldk B:411-686)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.40: Cullin homology domain [75631] (1 superfamily)
   3 domains: (1) 4-helical bundle; (2) alpha+beta; (3) "winged helix"-like

4. Superfamily e.40.1: Cullin homology domain [75632] (1 family)

5. Family e.40.1.1: Cullin homology domain [75633] (2 proteins)

6. Protein Cullin homolog 1, cul-1 [75634] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75635] (4 PDB entries)
   Uniprot Q13616 17-776

8. Domain d1ldkb2: 1ldk B:411-686 [73853]
   Other proteins in same PDB: d1ldka_, d1ldkb1, d1ldkc_, d1ldkd1, d1ldkd2, d1ldke1
   complexed with zn

Details for d1ldkb2

PDB Entry: 1ldk, 3.1 Å

PDB Description: structure of the cul1-rbx1-skp1-f boxskp2 scf ubiquitin ligase complex

PDB Compounds: (B:) cullin homolog

SCOPe Domain Sequences for d1ldkb2:

Sequence; same for both SEQRES and ATOM records:

>d1ldkb2 e.40.1.1 (B:411-686) Cullin homolog 1, cul-1 {Human (Homo sapiens) [TaxId: 9606]}
maqssskspellarycdsllkkssknpeeaeledtlnqvmvvfkyiedkdvfqkfyakml
akrlvhqnsasddaeasmisklkqacgfeytsklqrmfqdigvskdlneqfkkhltnsep
ldldfsiqvlssgswpfqqsctfalpselersyqrftafyasrhsgrkltwlyqlskgel
vtncfknrytlqastfqmaillqyntedaytvqqltdstqikmdilaqvlqillkskllv
ledenanvdevelkpdtliklylgyknkklrvninv

Timeline for d1ldkb2:

• d1ldkb2 first appeared in SCOP 1.61
  
• d1ldkb2 appears in SCOPe 2.07