Lineage for d1ldkb1 (1ldk B:687-776)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 905281Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 906051Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 906846Family a.4.5.34: SCF ubiquitin ligase complex WHB domain [74679] (3 proteins)
  6. 906847Protein Anaphase promoting complex (APC) [74680] (2 species)
  7. 906853Species Human (Homo sapiens) [TaxId:9606] [74682] (3 PDB entries)
    Uniprot Q13616 17-776
  8. 906856Domain d1ldkb1: 1ldk B:687-776 [73852]
    Other proteins in same PDB: d1ldka_, d1ldkb2, d1ldkc_, d1ldkd1, d1ldkd2, d1ldke1
    complexed with zn

Details for d1ldkb1

PDB Entry: 1ldk (more details), 3.1 Å

PDB Description: structure of the cul1-rbx1-skp1-f boxskp2 scf ubiquitin ligase complex
PDB Compounds: (B:) cullin homolog

SCOPe Domain Sequences for d1ldkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ldkb1 a.4.5.34 (B:687-776) Anaphase promoting complex (APC) {Human (Homo sapiens) [TaxId: 9606]}
pmkteqkqeqetthknieedrklliqaaivrimkmrkvlkhqqllgevltqlssrfkprv
pvikkcidiliekeylervdgekdtysyla

SCOPe Domain Coordinates for d1ldkb1:

Click to download the PDB-style file with coordinates for d1ldkb1.
(The format of our PDB-style files is described here.)

Timeline for d1ldkb1: