Lineage for d1ldia_ (1ldi A:)

  1. Root: SCOP 1.65
  2. 340091Class f: Membrane and cell surface proteins and peptides [56835] (36 folds)
  3. 340621Fold f.19: Aquaporin-like [81339] (1 superfamily)
    core: 8 helices, 2 short helices are surrounded by 6 long transmembrane helices
  4. 340622Superfamily f.19.1: Aquaporin-like [81338] (1 family) (S)
  5. 340623Family f.19.1.1: Aquaporin-like [56895] (2 proteins)
    duplication: consist of two similar structural parts
  6. 340631Protein Glycerol uptake facilitator protein GlpF [56898] (1 species)
    glycerol conducting channel, related to aquaporin
  7. 340632Species Escherichia coli [TaxId:562] [56899] (4 PDB entries)
  8. 340635Domain d1ldia_: 1ldi A: [73846]
    complexed with bog

Details for d1ldia_

PDB Entry: 1ldi (more details), 2.7 Å

PDB Description: crystal structure of the e. coli glycerol facilitator (glpf) without substrate glycerol

SCOP Domain Sequences for d1ldia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ldia_ f.19.1.1 (A:) Glycerol uptake facilitator protein GlpF {Escherichia coli}
tlkgqciaeflgtglliffgvgcvaalkvagasfgqweisviwglgvamaiyltagvsga
hlnpavtialwlfacfdkrkvipfivsqvagafcaaalvyglyynlffdfeqthhivrgs
vesvdlagtfstypnphinfvqafavemvitailmglilaltddgngvprgplaplligl
liavigasmgpltgfamnpardfgpkvfawlagwgnvaftggrdipyflvplfgpivgai
vgafayrkligrhl

SCOP Domain Coordinates for d1ldia_:

Click to download the PDB-style file with coordinates for d1ldia_.
(The format of our PDB-style files is described here.)

Timeline for d1ldia_: