Class f: Membrane and cell surface proteins and peptides [56835] (36 folds) |
Fold f.19: Aquaporin-like [81339] (1 superfamily) core: 8 helices, 2 short helices are surrounded by 6 long transmembrane helices |
Superfamily f.19.1: Aquaporin-like [81338] (1 family) |
Family f.19.1.1: Aquaporin-like [56895] (2 proteins) duplication: consist of two similar structural parts |
Protein Glycerol uptake facilitator protein GlpF [56898] (1 species) glycerol conducting channel, related to aquaporin |
Species Escherichia coli [TaxId:562] [56899] (4 PDB entries) |
Domain d1ldia_: 1ldi A: [73846] complexed with bog |
PDB Entry: 1ldi (more details), 2.7 Å
SCOP Domain Sequences for d1ldia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ldia_ f.19.1.1 (A:) Glycerol uptake facilitator protein GlpF {Escherichia coli} tlkgqciaeflgtglliffgvgcvaalkvagasfgqweisviwglgvamaiyltagvsga hlnpavtialwlfacfdkrkvipfivsqvagafcaaalvyglyynlffdfeqthhivrgs vesvdlagtfstypnphinfvqafavemvitailmglilaltddgngvprgplaplligl liavigasmgpltgfamnpardfgpkvfawlagwgnvaftggrdipyflvplfgpivgai vgafayrkligrhl
Timeline for d1ldia_: