Lineage for d1lddd_ (1ldd D:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 905281Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 906051Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 906846Family a.4.5.34: SCF ubiquitin ligase complex WHB domain [74679] (3 proteins)
  6. 906847Protein Anaphase promoting complex (APC) [74680] (2 species)
  7. 906848Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [74681] (1 PDB entry)
  8. 906852Domain d1lddd_: 1ldd D: [73844]

Details for d1lddd_

PDB Entry: 1ldd (more details), 2 Å

PDB Description: Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF Ubiquitin Ligase Complex
PDB Compounds: (D:) Anaphase Promoting Complex

SCOPe Domain Sequences for d1lddd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lddd_ a.4.5.34 (D:) Anaphase promoting complex (APC) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kyeltlqrslpfiegmltnlgamklhkihsflkitvpkdwgynritlqqlegylntlade
grlkyiangsyeiv

SCOPe Domain Coordinates for d1lddd_:

Click to download the PDB-style file with coordinates for d1lddd_.
(The format of our PDB-style files is described here.)

Timeline for d1lddd_: