Lineage for d1lddb_ (1ldd B:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 149792Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 150081Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (35 families) (S)
  5. 150456Family a.4.5.34: SCF ubiquitin ligase complex WHB domain [74679] (1 protein)
  6. 150457Protein Anaphase promoting complex (APC) [74680] (2 species)
  7. 150458Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [74681] (1 PDB entry)
  8. 150460Domain d1lddb_: 1ldd B: [73842]

Details for d1lddb_

PDB Entry: 1ldd (more details), 2 Å

PDB Description: Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF Ubiquitin Ligase Complex

SCOP Domain Sequences for d1lddb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lddb_ a.4.5.34 (B:) Anaphase promoting complex (APC) {Baker's yeast (Saccharomyces cerevisiae)}
kyeltlqrslpfiegmltnlgamklhkihsflkitvpkdwgynritlqqlegylntlade
grlkyiangsyeiv

SCOP Domain Coordinates for d1lddb_:

Click to download the PDB-style file with coordinates for d1lddb_.
(The format of our PDB-style files is described here.)

Timeline for d1lddb_: