Lineage for d1ldda_ (1ldd A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 761866Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) (S)
    contains a small beta-sheet (wing)
  5. 762622Family a.4.5.34: SCF ubiquitin ligase complex WHB domain [74679] (3 proteins)
  6. 762623Protein Anaphase promoting complex (APC) [74680] (2 species)
  7. 762624Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [74681] (1 PDB entry)
  8. 762625Domain d1ldda_: 1ldd A: [73841]

Details for d1ldda_

PDB Entry: 1ldd (more details), 2 Å

PDB Description: Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF Ubiquitin Ligase Complex
PDB Compounds: (A:) Anaphase Promoting Complex

SCOP Domain Sequences for d1ldda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ldda_ a.4.5.34 (A:) Anaphase promoting complex (APC) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kyeltlqrslpfiegmltnlgamklhkihsflkitvpkdwgynritlqqlegylntlade
grlkyiangsyeiv

SCOP Domain Coordinates for d1ldda_:

Click to download the PDB-style file with coordinates for d1ldda_.
(The format of our PDB-style files is described here.)

Timeline for d1ldda_: