SCOP 1.65: Domain d1ld8b_: 1ld8 B:

Lineage for d1ld8b_ (1ld8 B:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array

4. Superfamily a.102.4: Terpenoid cylases/Protein prenyltransferases [48239] (4 families)

5. Family a.102.4.3: Protein prenyltransferases [48246] (2 proteins)

6. Protein Protein farnesyltransferase, beta-subunit [48247] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69090] (4 PDB entries)

8. Domain d1ld8b_: 1ld8 B: [73839]
   Other proteins in same PDB: d1ld8a_
   complexed with acy, fpp, suc, u49, zn

Details for d1ld8b_

PDB Entry: 1ld8, 1.8 Å

PDB Description: co-crystal structure of human farnesyltransferase with farnesyldiphosphate and inhibitor compound 49

SCOP Domain Sequences for d1ld8b_:

Sequence; same for both SEQRES and ATOM records:

>d1ld8b_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Human (Homo sapiens)}
pvwseplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqre
khfhylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqsp
eggfgggpgqyphlaptyaavnalciigteeaydiinrekllqylyslkqpdgsflmhvg
gevdvrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcgl
aalvilkrerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralh
aqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhf
gsgamlhdvvlgvpenalqpthpvynigpdkviqattyflqkpvpgf

Timeline for d1ld8b_:

• d1ld8b_ first appeared in SCOP 1.61
  
• d1ld8b_ appears in SCOP 1.63
  
• d1ld8b_ appears in SCOP 1.67
  
• d1ld8b_ appears in the current release, SCOPe 2.08