Lineage for d1ld8b_ (1ld8 B:)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.102: alpha/alpha toroid [48207] (4 superfamilies) 
Superfamily a.102.4: Terpenoid cylases/Protein prenyltransferases [48239] (4 families) 
Family a.102.4.3: Protein prenyltransferases [48246] (2 proteins) Protein Protein farnesyltransferase, beta-subunit [48247] (2 species) Species Human (Homo sapiens) [TaxId:9606] [69090] (3 PDB entries) 
Domain d1ld8b_: 1ld8 B: [73839]
Other proteins in same PDB: d1ld8a_
Details for d1ld8b_
PDB Entry: 1ld8 (more details), 1.8 Å
PDB Description: co-crystal structure of human farnesyltransferase with farnesyldiphosphate and inhibitor compound 49
SCOP Domain Sequences for d1ld8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ld8b_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Human (Homo sapiens)}
pvwseplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqre
khfhylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqsp
eggfgggpgqyphlaptyaavnalciigteeaydiinrekllqylyslkqpdgsflmhvg
gevdvrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcgl
aalvilkrerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralh
aqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhf
gsgamlhdvvlgvpenalqpthpvynigpdkviqattyflqkpvpgf
SCOP Domain Coordinates for d1ld8b_:
Click to download the PDB-style file with coordinates for d1ld8b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ld8b_:
- d1ld8b_ is new in SCOP 1.61
- d1ld8b_ appears in SCOP 1.63
- d1ld8b_ appears in the current release, SCOPe 2.08
View in 3D
