![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
![]() | Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) ![]() |
![]() | Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins) |
![]() | Protein Protein farnesyltransferase, beta-subunit [48247] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [69090] (13 PDB entries) Uniprot P49356 |
![]() | Domain d1ld8b_: 1ld8 B: [73839] Other proteins in same PDB: d1ld8a_ complexed with acy, fpp, u49, zn |
PDB Entry: 1ld8 (more details), 1.8 Å
SCOPe Domain Sequences for d1ld8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ld8b_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Human (Homo sapiens) [TaxId: 9606]} pvwseplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqre khfhylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqsp eggfgggpgqyphlaptyaavnalciigteeaydiinrekllqylyslkqpdgsflmhvg gevdvrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcgl aalvilkrerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralh aqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhf gsgamlhdvvlgvpenalqpthpvynigpdkviqattyflqkpvpgf
Timeline for d1ld8b_: