Lineage for d1ld8a_ (1ld8 A:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 155820Fold a.118: alpha-alpha superhelix [48370] (16 superfamilies)
  4. 155963Superfamily a.118.6: Protein prenylyltransferase [48439] (1 family) (S)
  5. 155964Family a.118.6.1: Protein prenylyltransferase [48440] (2 proteins)
  6. 155965Protein Protein farnesyltransferase alpha-subunit [48441] (2 species)
  7. 155966Species Human (Homo sapiens) [TaxId:9606] [69093] (3 PDB entries)
  8. 155967Domain d1ld8a_: 1ld8 A: [73838]
    Other proteins in same PDB: d1ld8b_

Details for d1ld8a_

PDB Entry: 1ld8 (more details), 1.8 Å

PDB Description: Co-crystal structure of Human Farnesyltransferase with farnesyldiphosphate and inhibitor compound 49

SCOP Domain Sequences for d1ld8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ld8a_ a.118.6.1 (A:) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens)}
fvsldspsyvlyrdraewadidpvpqndgpnpvvqiiysdkfrdvydyfravlqrderse
rafkltrdaielnaanytvwhfrrvllkslqkdlheemnyitaiieeqpknyqvwhhrrv
lvewlrdpsqelefiadilnqdaknyhawqhrqwviqefklwdnelqyvdqllkedvrnn
svwnqryfvisnttgyndravlerevqytlemiklvphnesawnylkgilqdrglskypn
llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
ywryigrslqskh

SCOP Domain Coordinates for d1ld8a_:

Click to download the PDB-style file with coordinates for d1ld8a_.
(The format of our PDB-style files is described here.)

Timeline for d1ld8a_: