Class a: All alpha proteins [46456] (202 folds) |
Fold a.102: alpha/alpha toroid [48207] (5 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families) |
Family a.102.4.3: Protein prenyltransferases [48246] (2 proteins) |
Protein Protein farnesyltransferase, beta-subunit [48247] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [69090] (4 PDB entries) |
Domain d1ld7b_: 1ld7 B: [73837] Other proteins in same PDB: d1ld7a_ complexed with fpp, suc, u66, zn |
PDB Entry: 1ld7 (more details), 2 Å
SCOP Domain Sequences for d1ld7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ld7b_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Human (Homo sapiens)} pvwseplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqre khfhylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqsp eggfgggpgqyphlaptyaavnalciigteeaydiinrekllqylyslkqpdgsflmhvg gevdvrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcgl aalvilkrerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralh aqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhf gsgamlhdvvlgvpenalqpthpvynigpdkviqattyflqkpvpgf
Timeline for d1ld7b_: