SCOPe 2.01: Domain d1lcya2: 1lcy A:6-210

Lineage for d1lcya2 (1lcy A:6-210)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)

6. Protein Mitochondrial serine protease HtrA2, catalytic domain [74971] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74972] (1 PDB entry)

8. Domain d1lcya2: 1lcy A:6-210 [73835]
   Other proteins in same PDB: d1lcya1

Details for d1lcya2

PDB Entry: 1lcy, 2 Å

PDB Description: crystal structure of the mitochondrial serine protease htra2

PDB Compounds: (A:) HtrA2 serine protease

SCOPe Domain Sequences for d1lcya2:

Sequence, based on SEQRES records:

>d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
ppasprsqynfiadvvektapavvyieildrhpflgrevpisngsgfvvaadglivtnah
vvadrrrvrvrllsgdtyeavvtavdpvadiatlriqtkeplptlplgrsadvrqgefvv
amgspfalqntitsgivssaqrpardlglpqtnveyiqtdaaidfgnaggplvnldgevi
gvntmkvtagisfaipsdrlreflh

Sequence, based on observed residues (ATOM records):

>d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
ppasprsqynfiadvvektapavvyieildrhpflgrevpisngsgfvvaadglivtnah
vvadrrrvrvrllsgdtyeavvtavdpvadiatlriqtkeplptlplgrsadvrqgefvv
amgspfalqntitsgivssaqrpnveyiqtdaaidfgnaggplvnldgevigvntmkvta
gisfaipsdrlreflh

Timeline for d1lcya2:

• d1lcya2 first appeared in SCOP 1.61
  
• d1lcya2 appears in SCOP 1.75
  
• d1lcya2 appears in SCOPe 2.02
  
• d1lcya2 appears in the current release, SCOPe 2.08