Lineage for d1lcya2 (1lcy A:6-210)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 167857Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 167858Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 167859Family b.47.1.1: Prokaryotic proteases [50495] (11 proteins)
  6. 167917Protein Mitochondrial serine protease HtrA2, catalytic domain [74971] (1 species)
  7. 167918Species Human (Homo sapiens) [TaxId:9606] [74972] (1 PDB entry)
  8. 167919Domain d1lcya2: 1lcy A:6-210 [73835]
    Other proteins in same PDB: d1lcya1

Details for d1lcya2

PDB Entry: 1lcy (more details), 2 Å

PDB Description: crystal structure of the mitochondrial serine protease htra2

SCOP Domain Sequences for d1lcya2:

Sequence, based on SEQRES records: (download)

>d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens)}
ppasprsqynfiadvvektapavvyieildrhpflgrevpisngsgfvvaadglivtnah
vvadrrrvrvrllsgdtyeavvtavdpvadiatlriqtkeplptlplgrsadvrqgefvv
amgspfalqntitsgivssaqrpardlglpqtnveyiqtdaaidfgnaggplvnldgevi
gvntmkvtagisfaipsdrlreflh

Sequence, based on observed residues (ATOM records): (download)

>d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens)}
ppasprsqynfiadvvektapavvyieildrhpflgrevpisngsgfvvaadglivtnah
vvadrrrvrvrllsgdtyeavvtavdpvadiatlriqtkeplptlplgrsadvrqgefvv
amgspfalqntitsgivssaqrpnveyiqtdaaidfgnaggplvnldgevigvntmkvta
gisfaipsdrlreflh

SCOP Domain Coordinates for d1lcya2:

Click to download the PDB-style file with coordinates for d1lcya2.
(The format of our PDB-style files is described here.)

Timeline for d1lcya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lcya1