SCOP 1.75: Domain d1lcya1: 1lcy A:226-325

Lineage for d1lcya1 (1lcy A:226-325)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (6 families)
   peptide-binding domain

5. Family b.36.1.4: HtrA-like serine proteases [74933] (4 proteins)

6. Protein Mitochondrial serine protease HtrA2 [74936] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74937] (2 PDB entries)

8. Domain d1lcya1: 1lcy A:226-325 [73834]
   Other proteins in same PDB: d1lcya2
   mutant

Details for d1lcya1

PDB Entry: 1lcy, 2 Å

PDB Description: crystal structure of the mitochondrial serine protease htra2

PDB Compounds: (A:) HtrA2 serine protease

SCOP Domain Sequences for d1lcya1:

Sequence; same for both SEQRES and ATOM records:

>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]}
rryigvmmltlspsilaelqlrepsfpdvqhgvlihkvilgspahraglrpgdvilaige
qmvqnaedvyeavrtqsqlavqirrgretltlyvtpevte

Timeline for d1lcya1:

• d1lcya1 first appeared in SCOP 1.61
  
• d1lcya1 appears in SCOP 1.73
  
• d1lcya1 appears in SCOPe 2.01
  
• d1lcya1 appears in the current release, SCOPe 2.08