Lineage for d1lc7a_ (1lc7 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2502822Family c.67.1.1: AAT-like [53384] (17 proteins)
  6. 2503143Protein L-threonine-O-3-phosphate decarboxylase CobD [69563] (1 species)
  7. 2503144Species Salmonella enterica [TaxId:28901] [69564] (5 PDB entries)
  8. 2503149Domain d1lc7a_: 1lc7 A: [73828]
    complexed with po4, tpo

Details for d1lc7a_

PDB Entry: 1lc7 (more details), 1.8 Å

PDB Description: Crystal Structure of L-Threonine-O-3-phosphate Decarboxylase from S. enterica complexed with a substrate
PDB Compounds: (A:) L-Threonine-O-3-Phosphate Decarboxylase

SCOPe Domain Sequences for d1lc7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lc7a_ c.67.1.1 (A:) L-threonine-O-3-phosphate decarboxylase CobD {Salmonella enterica [TaxId: 28901]}
fntahggnirepatvlgispdqlldfsaninplgmpvsvkralidnldcierypdadyfh
lhqalarhhqvpaswilagngetesiftvasglkprramivtpgfaeygralaqsgceir
rwslreadgwqltdailealtpdldclflctpnnptgllperpllqaiadrckslninli
ldeafidfiphetgfipalkdnphiwvlrsltkfyaipglrlgylvnsddaamarmrrqq
mpwsvnalaalagevalqdsawqqatwhwlreegarfyqalcqlplltvypgranylllr
ceredidlqrrlltqrilirscanypgldsryyrvairsaaqnerllaalrnvltgia

SCOPe Domain Coordinates for d1lc7a_:

Click to download the PDB-style file with coordinates for d1lc7a_.
(The format of our PDB-style files is described here.)

Timeline for d1lc7a_: