Lineage for d1lc7a_ (1lc7 A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 183637Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
  4. 183638Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) (S)
  5. 183639Family c.67.1.1: AAT-like [53384] (6 proteins)
  6. 183817Protein L-threonine-O-3-phosphate decarboxylase CobD [69563] (1 species)
  7. 183818Species Salmonella enterica [TaxId:28901] [69564] (4 PDB entries)
  8. 183822Domain d1lc7a_: 1lc7 A: [73828]

Details for d1lc7a_

PDB Entry: 1lc7 (more details), 1.8 Å

PDB Description: Crystal Structure of L-Threonine-O-3-phosphate Decarboxylase from S. enterica complexed with a substrate

SCOP Domain Sequences for d1lc7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lc7a_ c.67.1.1 (A:) L-threonine-O-3-phosphate decarboxylase CobD {Salmonella enterica}
fntahggnirepatvlgispdqlldfsaninplgmpvsvkralidnldcierypdadyfh
lhqalarhhqvpaswilagngetesiftvasglkprramivtpgfaeygralaqsgceir
rwslreadgwqltdailealtpdldclflctpnnptgllperpllqaiadrckslninli
ldeafidfiphetgfipalkdnphiwvlrsltkfyaipglrlgylvnsddaamarmrrqq
mpwsvnalaalagevalqdsawqqatwhwlreegarfyqalcqlplltvypgranylllr
ceredidlqrrlltqrilirscanypgldsryyrvairsaaqnerllaalrnvltgia

SCOP Domain Coordinates for d1lc7a_:

Click to download the PDB-style file with coordinates for d1lc7a_.
(The format of our PDB-style files is described here.)

Timeline for d1lc7a_: