Lineage for d1lc3a1 (1lc3 A:2-128,A:247-293)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 175017Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 175018Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 175469Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (12 protein domains)
  6. 175482Protein Biliverdin reductase [51823] (1 species)
  7. 175483Species Rat (Rattus norvegicus) [TaxId:10116] [51824] (3 PDB entries)
  8. 175486Domain d1lc3a1: 1lc3 A:2-128,A:247-293 [73825]
    Other proteins in same PDB: d1lc3a2

Details for d1lc3a1

PDB Entry: 1lc3 (more details), 1.5 Å

PDB Description: Crystal Structure of a Biliverdin Reductase Enzyme-Cofactor Complex

SCOP Domain Sequences for d1lc3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lc3a1 c.2.1.3 (A:2-128,A:247-293) Biliverdin reductase {Rat (Rattus norvegicus)}
mitnsgkfgvvvvgvgragsvrlrdlkdprsaaflnligfvsrrelgsldevrqisleda
lrsqeidvayicsessshedyirqflqagkhvlveypmtlsfaaaqelwelaaqkgrvlh
eehvellXkniflkdqdifvqklldqvsaedlaaekkrimhclglasdiqklchq

SCOP Domain Coordinates for d1lc3a1:

Click to download the PDB-style file with coordinates for d1lc3a1.
(The format of our PDB-style files is described here.)

Timeline for d1lc3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lc3a2