Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) N-terminal domain is the classic Rossmann-fold |
Family d.81.1.4: Biliverdin reductase [55373] (1 protein) automatically mapped to Pfam PF09166 |
Protein Biliverdin reductase [55374] (1 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [55375] (3 PDB entries) |
Domain d1lc0a2: 1lc0 A:129-246 [73824] Other proteins in same PDB: d1lc0a1 complexed with po4 |
PDB Entry: 1lc0 (more details), 1.2 Å
SCOPe Domain Sequences for d1lc0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lc0a2 d.81.1.4 (A:129-246) Biliverdin reductase {Norway rat (Rattus norvegicus) [TaxId: 10116]} meefeflrrevlgkellkgslrftaspleeerfgfpafsgisrltwlvslfgelslisat leerkedqymkmtvqletqnkgllswieekgpglkrnryvnfqftsgsleevpsvgvn
Timeline for d1lc0a2: