Lineage for d1lbvb_ (1lbv B:)

  1. Root: SCOPe 2.01
  2. 1054197Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1055431Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. 1055432Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) (S)
  5. 1055433Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 proteins)
  6. 1055442Protein Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase [56665] (4 species)
  7. 1055443Species Archaeoglobus fulgidus [TaxId:2234] [75608] (5 PDB entries)
  8. 1055445Domain d1lbvb_: 1lbv B: [73814]

Details for d1lbvb_

PDB Entry: 1lbv (more details), 1.8 Å

PDB Description: Crystal Structure of apo-form (P21) of dual activity FBPase/IMPase (AF2372) from Archaeoglobus fulgidus
PDB Compounds: (B:) fructose 1,6-bisphosphatase/inositol monophosphatase

SCOPe Domain Sequences for d1lbvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lbvb_ e.7.1.1 (B:) Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase {Archaeoglobus fulgidus [TaxId: 2234]}
mderdalrisreiagevrkaiasmplrervkdvgmgkdgtptkaadrvaedaaleilrke
rvtvvteesgvlgegdvfvaldpldgtfnatrgipvysvslcfsysdklkdaffgyvynl
atgdeyyadssgayrngerievsdaeelycnaiiyypdrkfpfkrmrifgsaatelcffa
dgsfdcfldirpgkmlriydaaagvfiaekaggkvteldgeslgnkkfdmqerlnivaan
eklhpkllelik

SCOPe Domain Coordinates for d1lbvb_:

Click to download the PDB-style file with coordinates for d1lbvb_.
(The format of our PDB-style files is described here.)

Timeline for d1lbvb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1lbva_