SCOP 1.61: Domain d1lbkb2: 1lbk B:1-76

Lineage for d1lbkb2 (1lbk B:1-76)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)

4. Superfamily c.47.1: Thioredoxin-like [52833] (12 families)

5. Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)

6. Protein Glutathione S-transferase [52863] (27 species)

7. Species Human (Homo sapiens), class pi [TaxId:9606] [52864] (33 PDB entries)

8. Domain d1lbkb2: 1lbk B:1-76 [73812]
   Other proteins in same PDB: d1lbka1, d1lbkb1

Details for d1lbkb2

PDB Entry: 1lbk, 1.86 Å

PDB Description: crystal structure of a recombinant glutathione transferase, created by replacing the last seven residues of each subunit of the human class pi isoenzyme with the additional c-terminal helix of human class alpha isoenzyme

SCOP Domain Sequences for d1lbkb2:

Sequence; same for both SEQRES and ATOM records:

>d1lbkb2 c.47.1.5 (B:1-76) Glutathione S-transferase {Human (Homo sapiens), class pi}
ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
tlyqsntilrhlgrtl

Timeline for d1lbkb2:

• d1lbkb2 is new in SCOP 1.61
  
• d1lbkb2 appears in SCOP 1.63
  
• d1lbkb2 appears in the current release, SCOPe 2.08