Lineage for d1lbfa_ (1lbf A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 172806Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families) (S)
  5. 172903Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (3 proteins)
  6. 172904Protein Indole-3-glycerophosphate synthase, IPGS [51385] (3 species)
  7. 172905Species Archaeon Sulfolobus solfataricus [TaxId:2287] [51387] (5 PDB entries)
  8. 172909Domain d1lbfa_: 1lbf A: [73808]

Details for d1lbfa_

PDB Entry: 1lbf (more details), 2.05 Å

PDB Description: crystal structure of indole-3-glycerol phosphate syntase (igps)with reduced 1-(o-caboxyphenylamino)-1-deoxyribulose 5-phosphate (rcdrp)

SCOP Domain Sequences for d1lbfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lbfa_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Archaeon Sulfolobus solfataricus}
prylkgwlkdvvqlslrrpsfrasrqrpiislnerilefnkrnitaiiaeykrkspsgld
verdpieyskfmeryavglsilteekyfngsyetlrkiassvsipilmkdfivkesqidd
aynlgadtvllivkiltereleslleyarsygmeplieindendldialrigarfigins
rdletleinkenqrklismipsnvvkvaesgiserneieelrklgvnafligsslmrnpe
kikefil

SCOP Domain Coordinates for d1lbfa_:

Click to download the PDB-style file with coordinates for d1lbfa_.
(The format of our PDB-style files is described here.)

Timeline for d1lbfa_: