Lineage for d1lbfa_ (1lbf A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079565Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 protein domains)
  6. 2079566Protein Indole-3-glycerophosphate synthase, IPGS [51385] (4 species)
  7. 2079570Species Sulfolobus solfataricus [TaxId:2287] [51387] (6 PDB entries)
  8. 2079572Domain d1lbfa_: 1lbf A: [73808]
    complexed with 137

Details for d1lbfa_

PDB Entry: 1lbf (more details), 2.05 Å

PDB Description: crystal structure of indole-3-glycerol phosphate syntase (igps)with reduced 1-(o-caboxyphenylamino)-1-deoxyribulose 5-phosphate (rcdrp)
PDB Compounds: (A:) indole-3-glycerol phosphate synthase

SCOPe Domain Sequences for d1lbfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lbfa_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Sulfolobus solfataricus [TaxId: 2287]}
prylkgwlkdvvqlslrrpsfrasrqrpiislnerilefnkrnitaiiaeykrkspsgld
verdpieyskfmeryavglsilteekyfngsyetlrkiassvsipilmkdfivkesqidd
aynlgadtvllivkiltereleslleyarsygmeplieindendldialrigarfigins
rdletleinkenqrklismipsnvvkvaesgiserneieelrklgvnafligsslmrnpe
kikefil

SCOPe Domain Coordinates for d1lbfa_:

Click to download the PDB-style file with coordinates for d1lbfa_.
(The format of our PDB-style files is described here.)

Timeline for d1lbfa_: