SCOP 1.61: Domain d1lbcc_: 1lbc C:

Lineage for d1lbcc_ (1lbc C:)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families)

5. Family c.94.1.1: Phosphate binding protein-like [53851] (18 proteins)

6. Protein Glutamate receptor ligand binding core [53881] (2 species)

7. Species Rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (11 PDB entries)

8. Domain d1lbcc_: 1lbc C: [73807]

Details for d1lbcc_

PDB Entry: 1lbc, 1.8 Å

PDB Description: Crystal structure of GluR2 ligand binding core (S1S2J-N775S) in complex with cyclothiazide (CTZ) as well as glutamate at 1.8 A resolution

SCOP Domain Sequences for d1lbcc_:

Sequence; same for both SEQRES and ATOM records:

>d1lbcc_ c.94.1.1 (C:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2}
ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklse
qglldklknkwwydkgec

Timeline for d1lbcc_:

• d1lbcc_ is new in SCOP 1.61
  
• d1lbcc_ appears in SCOP 1.63
  
• d1lbcc_ appears in the current release, SCOPe 2.08