Lineage for d1lb8b_ (1lb8 B:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 250728Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 250729Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 250730Family c.94.1.1: Phosphate binding protein-like [53851] (19 proteins)
  6. 250795Protein Glutamate receptor ligand binding core [53881] (2 species)
  7. 250796Species Rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (18 PDB entries)
  8. 250831Domain d1lb8b_: 1lb8 B: [73801]
    complexed with amq; mutant

Details for d1lb8b_

PDB Entry: 1lb8 (more details), 2.3 Å

PDB Description: crystal structure of the non-desensitizing glur2 ligand binding core mutant (s1s2j-l483y) in complex with ampa at 2.3 resolution

SCOP Domain Sequences for d1lb8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lb8b_ c.94.1.1 (B:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2}
ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
rdadtkiwngmvgelvygkadiaiapltityvreevidfskpfmslgisimikkgtpies
aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklne
qglldklknkwwydkgecg

SCOP Domain Coordinates for d1lb8b_:

Click to download the PDB-style file with coordinates for d1lb8b_.
(The format of our PDB-style files is described here.)

Timeline for d1lb8b_: