Lineage for d1lb6a_ (1lb6 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2045537Fold b.8: TRAF domain-like [49598] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2045538Superfamily b.8.1: TRAF domain-like [49599] (3 families) (S)
    has a circularly permuted immunoglobulin-fold topology with extra strand
  5. 2045539Family b.8.1.1: MATH domain [49600] (5 proteins)
    automatically mapped to Pfam PF00917
  6. 2045614Protein TNF receptor associated factor 6 (TRAF6) [74883] (1 species)
  7. 2045615Species Human (Homo sapiens) [TaxId:9606] [74884] (3 PDB entries)
  8. 2045616Domain d1lb6a_: 1lb6 A: [73798]
    complexed with a CD40 peptide, chain B

Details for d1lb6a_

PDB Entry: 1lb6 (more details), 1.8 Å

PDB Description: traf6-cd40 complex
PDB Compounds: (A:) TNF receptor-associated factor 6

SCOPe Domain Sequences for d1lb6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lb6a_ b.8.1.1 (A:) TNF receptor associated factor 6 (TRAF6) {Human (Homo sapiens) [TaxId: 9606]}
qqcngiyiwkignfgmhlkcqeeekpvvihspgfytgkpgyklcmrlhlqlptaqrcany
islfvhtmqgeydshlpwpfqgtirltildqseapvrqnheeimdakpellafqrptipr
npkgfgyvtfmhlealrqrtfikddtllvrcevst

SCOPe Domain Coordinates for d1lb6a_:

Click to download the PDB-style file with coordinates for d1lb6a_.
(The format of our PDB-style files is described here.)

Timeline for d1lb6a_: