SCOP 1.63: Domain d1lb6a_: 1lb6 A:

Lineage for d1lb6a_ (1lb6 A:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.8: TRAF domain-like [49598] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.8.1: TRAF domain-like [49599] (2 families)
   has a cirularly permuted immunoglobulin-fold topology with extra strand

5. Family b.8.1.1: TRAF domain [49600] (3 proteins)

6. Protein TNF receptor associated factor 6 (TRAF6) [74883] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74884] (3 PDB entries)

8. Domain d1lb6a_: 1lb6 A: [73798]
   complexed with a CD40 peptide, chain B

Details for d1lb6a_

PDB Entry: 1lb6, 1.8 Å

PDB Description: traf6-cd40 complex

SCOP Domain Sequences for d1lb6a_:

Sequence; same for both SEQRES and ATOM records:

>d1lb6a_ b.8.1.1 (A:) TNF receptor associated factor 6 (TRAF6) {Human (Homo sapiens)}
qqcngiyiwkignfgmhlkcqeeekpvvihspgfytgkpgyklcmrlhlqlptaqrcany
islfvhtmqgeydshlpwpfqgtirltildqseapvrqnheeimdakpellafqrptipr
npkgfgyvtfmhlealrqrtfikddtllvrcevst

Timeline for d1lb6a_:

• d1lb6a_ first appeared in SCOP 1.61
  
• d1lb6a_ appears in SCOP 1.65
  
• d1lb6a_ appears in the current release, SCOPe 2.08