![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.8: TRAF domain-like [49598] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key |
![]() | Superfamily b.8.1: TRAF domain-like [49599] (3 families) ![]() has a circularly permuted immunoglobulin-fold topology with extra strand |
![]() | Family b.8.1.1: MATH domain [49600] (5 proteins) automatically mapped to Pfam PF00917 |
![]() | Protein TNF receptor associated factor 6 (TRAF6) [74883] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [74884] (3 PDB entries) |
![]() | Domain d1lb6a_: 1lb6 A: [73798] complexed with a CD40 peptide, chain B |
PDB Entry: 1lb6 (more details), 1.8 Å
SCOPe Domain Sequences for d1lb6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lb6a_ b.8.1.1 (A:) TNF receptor associated factor 6 (TRAF6) {Human (Homo sapiens) [TaxId: 9606]} qqcngiyiwkignfgmhlkcqeeekpvvihspgfytgkpgyklcmrlhlqlptaqrcany islfvhtmqgeydshlpwpfqgtirltildqseapvrqnheeimdakpellafqrptipr npkgfgyvtfmhlealrqrtfikddtllvrcevst
Timeline for d1lb6a_: