Lineage for d1lb5a_ (1lb5 A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 163160Fold b.8: TRAF domain-like [49598] (1 superfamily)
  4. 163161Superfamily b.8.1: TRAF domain-like [49599] (2 families) (S)
  5. 163162Family b.8.1.1: TRAF domain [49600] (3 proteins)
  6. 163215Protein TNF receptor associated factor 6 (TRAF6) [74883] (1 species)
  7. 163216Species Human (Homo sapiens) [TaxId:9606] [74884] (3 PDB entries)
  8. 163219Domain d1lb5a_: 1lb5 A: [73797]

Details for d1lb5a_

PDB Entry: 1lb5 (more details), 2.4 Å

PDB Description: traf6-rank complex

SCOP Domain Sequences for d1lb5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lb5a_ b.8.1.1 (A:) TNF receptor associated factor 6 (TRAF6) {Human (Homo sapiens)}
qqcngiyiwkignfgmhlkcqeeekpvvihspgfytgkpgyklcmrlhlqlptaqrcany
islfvhtmqgeydshlpwpfqgtirltildqseapvrqnheeimdakpellafqrptipr
npkgfgyvtfmhlealrqrtfikddtllvrcevst

SCOP Domain Coordinates for d1lb5a_:

Click to download the PDB-style file with coordinates for d1lb5a_.
(The format of our PDB-style files is described here.)

Timeline for d1lb5a_: