Lineage for d1lb5a_ (1lb5 A:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.8: TRAF domain-like [49598] (1 superfamily) Superfamily b.8.1: TRAF domain-like [49599] (2 families) 
Family b.8.1.1: TRAF domain [49600] (3 proteins) Protein TNF receptor associated factor 6 (TRAF6) [74883] (1 species) Species Human (Homo sapiens) [TaxId:9606] [74884] (3 PDB entries) 
Domain d1lb5a_: 1lb5 A: [73797]
Details for d1lb5a_
PDB Entry: 1lb5 (more details), 2.4 Å
PDB Description: traf6-rank complex
SCOP Domain Sequences for d1lb5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lb5a_ b.8.1.1 (A:) TNF receptor associated factor 6 (TRAF6) {Human (Homo sapiens)}
qqcngiyiwkignfgmhlkcqeeekpvvihspgfytgkpgyklcmrlhlqlptaqrcany
islfvhtmqgeydshlpwpfqgtirltildqseapvrqnheeimdakpellafqrptipr
npkgfgyvtfmhlealrqrtfikddtllvrcevst
SCOP Domain Coordinates for d1lb5a_:
Click to download the PDB-style file with coordinates for d1lb5a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lb5a_:
- d1lb5a_ is new in SCOP 1.61
- d1lb5a_ appears in SCOP 1.63
- d1lb5a_ appears in the current release, SCOPe 2.08
View in 3D