Lineage for d1lb4a1 (1lb4 A:348-504)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2038446Fold b.8: TRAF domain-like [49598] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2038447Superfamily b.8.1: TRAF domain-like [49599] (3 families) (S)
    has a circularly permuted immunoglobulin-fold topology with extra strand
  5. 2038448Family b.8.1.1: MATH domain [49600] (5 protein domains)
    automatically mapped to Pfam PF00917
  6. 2038523Protein TNF receptor associated factor 6 (TRAF6) [74883] (1 species)
  7. 2038524Species Human (Homo sapiens) [TaxId:9606] [74884] (3 PDB entries)
  8. 2038526Domain d1lb4a1: 1lb4 A:348-504 [73796]
    Other proteins in same PDB: d1lb4a2

Details for d1lb4a1

PDB Entry: 1lb4 (more details), 2.4 Å

PDB Description: traf6 apo structure
PDB Compounds: (A:) TNF receptor-associated factor 6

SCOPe Domain Sequences for d1lb4a1:

Sequence, based on SEQRES records: (download)

>d1lb4a1 b.8.1.1 (A:348-504) TNF receptor associated factor 6 (TRAF6) {Human (Homo sapiens) [TaxId: 9606]}
qcngiyiwkignfgmhlkcqeeekpvvihspgfytgkpgyklcmrlhlqlptaqrcanyi
slfvhtmqgeydshlpwpfqgtirltildqseapvrqnheeimdakpellafqrptiprn
pkgfgyvtfmhlealrqrtfikddtllvrcevstrfd

Sequence, based on observed residues (ATOM records): (download)

>d1lb4a1 b.8.1.1 (A:348-504) TNF receptor associated factor 6 (TRAF6) {Human (Homo sapiens) [TaxId: 9606]}
qcngiyiwkignfgmhlkcqeeekpvvihspgfytgkpgyklcmrlhlqlptaqrcanyi
slfvhtmqgeydshlpwpfqgtirltildqseapvrqnheeimdakpellafqrptikgf
gyvtfmhlealrqrtfikddtllvrcevstrfd

SCOPe Domain Coordinates for d1lb4a1:

Click to download the PDB-style file with coordinates for d1lb4a1.
(The format of our PDB-style files is described here.)

Timeline for d1lb4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lb4a2