| Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (45 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein RhoA [52612] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [52613] (12 PDB entries) |
| Domain d1lb1b_: 1lb1 B: [73786] Other proteins in same PDB: d1lb1a1, d1lb1a2, d1lb1c1, d1lb1c2, d1lb1e1, d1lb1e2, d1lb1g1, d1lb1g2 |
PDB Entry: 1lb1 (more details), 2.81 Å
SCOP Domain Sequences for d1lb1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lb1b_ c.37.1.8 (B:) RhoA {Human (Homo sapiens)}
airkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdtag
qedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlr
ndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalq
Timeline for d1lb1b_: