SCOP 1.61: Domain d1la2d2: 1la2 D:323-437

Lineage for d1la2d2 (1la2 D:323-437)

Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (5 proteins)
Protein Myo-inositol 1-phosphate synthase [75484] (2 species)
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [75486] (3 PDB entries)
Domain d1la2d2: 1la2 D:323-437 [73780]
Other proteins in same PDB: d1la2a1, d1la2b1, d1la2c1, d1la2d1

Details for d1la2d2

PDB Entry: 1la2 (more details), 2.65 Å

PDB Description: structural analysis of saccharomyces cerevisiae myo-inositol phosphate synthase

SCOP Domain Sequences for d1la2d2:

Sequence, based on SEQRES records: (download)

>d1la2d2 d.81.1.3 (D:323-437) Myo-inositol 1-phosphate synthase {Baker's yeast (Saccharomyces cerevisiae)}
sgqtklksvlaqflvdagikpvsiasynhlgnndgynlsapkqfrskeiskssviddiia
sndilyndklgkkvdhcivikymkpvgdskvamdeyyselmlgghnrisihnvce

Sequence, based on observed residues (ATOM records): (download)

>d1la2d2 d.81.1.3 (D:323-437) Myo-inositol 1-phosphate synthase {Baker's yeast (Saccharomyces cerevisiae)}
sgqtklksvlaqflvdagikpvsiasynhlgnndgynlsapksviddiiasndilyndkl
gkkvdhcivikymkpvgdskvamdeyyselmlgghnrisihnvce

SCOP Domain Coordinates for d1la2d2:

Click to download the PDB-style file with coordinates for d1la2d2.
(The format of our PDB-style files is described here.)

Timeline for d1la2d2: