Lineage for d1la2a2 (1la2 A:323-437)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 331066Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 331067Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 331255Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (5 proteins)
  6. 331292Protein Myo-inositol 1-phosphate synthase [75484] (2 species)
  7. 331293Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [75486] (8 PDB entries)
  8. 331310Domain d1la2a2: 1la2 A:323-437 [73774]
    Other proteins in same PDB: d1la2a1, d1la2b1, d1la2c1, d1la2d1

Details for d1la2a2

PDB Entry: 1la2 (more details), 2.65 Å

PDB Description: Structural analysis of Saccharomyces cerevisiae myo-inositol phosphate synthase

SCOP Domain Sequences for d1la2a2:

Sequence, based on SEQRES records: (download)

>d1la2a2 d.81.1.3 (A:323-437) Myo-inositol 1-phosphate synthase {Baker's yeast (Saccharomyces cerevisiae)}
sgqtklksvlaqflvdagikpvsiasynhlgnndgynlsapkqfrskeiskssviddiia
sndilyndklgkkvdhcivikymkpvgdskvamdeyyselmlgghnrisihnvce

Sequence, based on observed residues (ATOM records): (download)

>d1la2a2 d.81.1.3 (A:323-437) Myo-inositol 1-phosphate synthase {Baker's yeast (Saccharomyces cerevisiae)}
sgqtklksvlaqflvdagikpvsiasynhlgnndgynlsapksviddiiasndilyndkl
gkkvdhcivikymkpvgdskvamdeyyselmlgghnrisihnvce

SCOP Domain Coordinates for d1la2a2:

Click to download the PDB-style file with coordinates for d1la2a2.
(The format of our PDB-style files is described here.)

Timeline for d1la2a2: