Lineage for d1l9ze_ (1l9z E:)

  1. Root: SCOP 1.69
  2. 526321Class i: Low resolution protein structures [58117] (24 folds)
  3. 527484Fold i.8: RNA polymerase [58180] (1 superfamily)
  4. 527485Superfamily i.8.1: RNA polymerase [58181] (1 family) (S)
  5. 527486Family i.8.1.1: RNA polymerase [58182] (2 proteins)
  6. 527549Protein DNA-directed RNA polymerase alpha(2), beta, beta-prime and omega subunits [58183] (1 species)
  7. 527550Species Thermus aquaticus [TaxId:271] [58184] (3 PDB entries)
  8. 527572Domain d1l9ze_: 1l9z E: [73770]

Details for d1l9ze_

PDB Entry: 1l9z (more details), 6.5 Å

PDB Description: Thermus aquaticus RNA Polymerase Holoenzyme/Fork-Junction Promoter DNA Complex at 6.5 A Resolution

SCOP Domain Sequences for d1l9ze_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l9ze_ i.8.1.1 (E:) DNA-directed RNA polymerase alpha(2), beta, beta-prime and omega subunits {Thermus aquaticus}
aepgidklfgmvdskyrltvvvakraqqllrhrfkntvlepeerpkmrtleglyddpnav
twamkelltgrlffgenlvpedrlqkemerly

SCOP Domain Coordinates for d1l9ze_:

Click to download the PDB-style file with coordinates for d1l9ze_.
(The format of our PDB-style files is described here.)

Timeline for d1l9ze_: