Lineage for d1l9va2 (1l9v A:1-143)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 265772Fold d.216: Rotavirus NSP2 fragment, N-terminal domain [75573] (1 superfamily)
    consists of six alpha-helices and two beta-hairpins
  4. 265773Superfamily d.216.1: Rotavirus NSP2 fragment, N-terminal domain [75574] (1 family) (S)
  5. 265774Family d.216.1.1: Rotavirus NSP2 fragment, N-terminal domain [75575] (1 protein)
  6. 265775Protein Rotavirus NSP2 fragment, N-terminal domain [75576] (1 species)
  7. 265776Species Simian 11 rotavirus [TaxId:10923] [75577] (1 PDB entry)
  8. 265777Domain d1l9va2: 1l9v A:1-143 [73761]
    Other proteins in same PDB: d1l9va1

Details for d1l9va2

PDB Entry: 1l9v (more details), 2.6 Å

PDB Description: Non Structural protein encoded by gene segment 8 of rotavirus (NSP2), an NTPase, ssRNA binding and nucleic acid helix-destabilizing protein

SCOP Domain Sequences for d1l9va2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l9va2 d.216.1.1 (A:1-143) Rotavirus NSP2 fragment, N-terminal domain {Simian 11 rotavirus}
maelacfcyphlendsykfipfnnlaikamltakvdkkdmdkfydsiiygiapppqfkkr
yntndnsrgmnfetimftkvamlicealnslkvtqanvsnvlsrvvsirhlenlvirken
pqdilfhskdlllkstliaigqs

SCOP Domain Coordinates for d1l9va2:

Click to download the PDB-style file with coordinates for d1l9va2.
(The format of our PDB-style files is described here.)

Timeline for d1l9va2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1l9va1