Lineage for d1l9uh_ (1l9u H:)

  1. Root: SCOP 1.73
  2. 753709Class i: Low resolution protein structures [58117] (26 folds)
  3. 755052Fold i.8: RNA polymerase [58180] (1 superfamily)
  4. 755053Superfamily i.8.1: RNA polymerase [58181] (1 family) (S)
  5. 755054Family i.8.1.1: RNA polymerase [58182] (2 proteins)
  6. 755205Protein DNA-directed RNA polymerase alpha(2), beta, beta-prime and omega subunits [58183] (1 species)
  7. 755206Species Thermus aquaticus [TaxId:271] [58184] (3 PDB entries)
  8. 755212Domain d1l9uh_: 1l9u H: [73753]

Details for d1l9uh_

PDB Entry: 1l9u (more details), 4 Å

PDB Description: thermus aquaticus rna polymerase holoenzyme at 4 a resolution
PDB Compounds: (H:) sigma factor sigA

SCOP Domain Sequences for d1l9uh_:

Sequence, based on SEQRES records: (download)

>d1l9uh_ i.8.1.1 (H:) DNA-directed RNA polymerase alpha(2), beta, beta-prime and omega subunits {Thermus aquaticus [TaxId: 271]}
sdpvrqylheigqvplltleeeidlarkveegmeaikklseatgldqelirevvrakilg
tarveevdgklkslpkelkrylhiaregeaarqhlieanlrlvvsiakkytgrglsfldl
iqegnqgliravekfeykrrfkfstyatwwirqainraiadqartiripvhmvetinkls
rtarqlqqelgrepsyeeiaeamgpgwdakrveetlkiaqepvsletpigdekdsfygdf
ipdenlpspveaaaqsllseelekalsklsereamvlklrkglidgrehtleevgayfgv
trerirqienkalrklkyhesrtrklrdfle

Sequence, based on observed residues (ATOM records): (download)

>d1l9uh_ i.8.1.1 (H:) DNA-directed RNA polymerase alpha(2), beta, beta-prime and omega subunits {Thermus aquaticus [TaxId: 271]}
sdpvrqylheigqvplltleeeidlarkveegmeaikklseatgldqelirevvrakilg
tarveevdgklkslpkelkrylhiaregeaarqhlieanlrlvvsiakkytgrglsfldl
iqegnqgliravekfeykrrfkfstyatwwirqainraiadqartiripvhmvetinkls
rtarqlqqelgrepsyeeiaeamgpgwdakrveetlkiaqepvsletpidfipdenlpsp
veaaaqsllseelekalsklsereamvlklrkglidgrehtleevgayfgvtrerirqie
nkalrklkyhesrtrklrdfle

SCOP Domain Coordinates for d1l9uh_:

Click to download the PDB-style file with coordinates for d1l9uh_.
(The format of our PDB-style files is described here.)

Timeline for d1l9uh_: