Lineage for d1l9ue_ (1l9u E:)

  1. Root: SCOP 1.67
  2. 432183Class i: Low resolution protein structures [58117] (22 folds)
  3. 433235Fold i.8: RNA polymerase [58180] (1 superfamily)
  4. 433236Superfamily i.8.1: RNA polymerase [58181] (1 family) (S)
  5. 433237Family i.8.1.1: RNA polymerase [58182] (2 proteins)
  6. 433300Protein DNA-directed RNA polymerase alpha(2), beta, beta-prime and omega subunits [58183] (1 species)
  7. 433301Species Thermus aquaticus [TaxId:271] [58184] (3 PDB entries)
  8. 433306Domain d1l9ue_: 1l9u E: [73752]

Details for d1l9ue_

PDB Entry: 1l9u (more details), 4 Å

PDB Description: thermus aquaticus rna polymerase holoenzyme at 4 a resolution

SCOP Domain Sequences for d1l9ue_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l9ue_ i.8.1.1 (E:) DNA-directed RNA polymerase alpha(2), beta, beta-prime and omega subunits {Thermus aquaticus}
aepgidklfgmvdskyrltvvvakraqqllrhrfkntvlepeerpkmrtleglyddpnav
twamkelltgrlffgenlvpedrlqkemerly

SCOP Domain Coordinates for d1l9ue_:

Click to download the PDB-style file with coordinates for d1l9ue_.
(The format of our PDB-style files is described here.)

Timeline for d1l9ue_: