Lineage for d1l9uc_ (1l9u C:)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3044682Fold i.8: RNA polymerase [58180] (1 superfamily)
  4. 3044683Superfamily i.8.1: RNA polymerase [58181] (1 family) (S)
  5. 3044684Family i.8.1.1: RNA polymerase [58182] (2 proteins)
  6. 3044852Protein DNA-directed RNA polymerase alpha(2), beta, beta-prime and omega subunits [58183] (1 species)
  7. 3044853Species Thermus aquaticus [TaxId:271] [58184] (3 PDB entries)
  8. 3044861Domain d1l9uc_: 1l9u C: [73750]
    holoenzyme at 4 Angstrom resolution
    complexed with mg, zn

Details for d1l9uc_

PDB Entry: 1l9u (more details), 4 Å

PDB Description: thermus aquaticus rna polymerase holoenzyme at 4 a resolution
PDB Compounds: (C:) RNA polymerase, beta subunit

SCOPe Domain Sequences for d1l9uc_:

Sequence, based on SEQRES records: (download)

>d1l9uc_ i.8.1.1 (C:) DNA-directed RNA polymerase alpha(2), beta, beta-prime and omega subunits {Thermus aquaticus [TaxId: 271]}
eikrfgrireviplpplteiqvesykkalqadvppekrenvgiqaafketfpieegdkgk
gglvldfleyrigdppfsqdecrekdltyqaplyarlqlihkdtglikedevflghlplm
tedgsfiingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidleveasgv
vtmkvnkrkfplvlllrvlgydqetlvrelsaygdlvqglldeavlamrpeeamvrlftl
lrpgdppkkdkalaylfglladpkrydlgeagrykaeeklgvglsgrtlvrfedgefkde
vflptlrylfaltagvpghevddidhlgnrrirtvgelmadqfrvglarlargvrermvm
gspdtltpaklvnsrpleaalreffsrsqlsqfkdetnplsslrhkrrisalgpggltre
ragfdvrdvhrthygricpvetpeganiglitslaayarvdalgfirtpyrrvkngvvte
evvymtaseedrytiaqantplegdriatdrvvarrrgepvivapeevefmdvspkqvfs
lntnlipflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeedg
evvkvdgtriavryedgrlvhplrryarsnqgtafdqrprvrvgqrvkkgdlladgpase
egflalgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgperi
trdiphlseaalrdldeegivrigaevkpgdilvgrtsfkgeqepspeerllrsifgeka
rdvkdtslrvppgeggivvgrlrlrrgdpgvelkpgvrevvrvfvaqkrklqvgdklanr
hgnkgvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqryi
spvfdgatepeikellaeafnlyfgkrqgegfgvdkrekevlaraeklglvspgkspeeq
lkelfdlgkvvlydgrtgepfegpivvgqmfimklyhmvedkmharstgpyslitqqplg
gkaqfggqrfgemevwaleaygaahtlqemltiksddiegrnaayqaiikgedvpepsvp
esfrvlvkelqalaldvqtldekdnpvdifegla

Sequence, based on observed residues (ATOM records): (download)

>d1l9uc_ i.8.1.1 (C:) DNA-directed RNA polymerase alpha(2), beta, beta-prime and omega subunits {Thermus aquaticus [TaxId: 271]}
eikrfgrireviplpplteiqvesykkalqadvppekrenvgiqaafketfpieeglvld
fleyrigdppfsqdecrekdltyqaplyarlqlihkdtglikedevflghlplmtedgsf
iingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidleveasgvvtmkvn
krkfplvlllrvlgydqetlvrelsglldeavlamrpeeamvrlftllrpglaylfglla
dpkrydlgeagrykaeeklgvglsgrtlvfkdevflptlrylfaltagvpghevddidhl
gnrrirtvgelmadqfrvglarlargvrermvmgspdtltpaklvnsrpleaalreffsr
sqlsqfkdetnplsslrhkrrisalgpggltreragfdvrdvhrthygricpvetpegan
iglitslaayarvdalgfirtpyrrvkngvvteevvymtaseedrytiaqantplegdri
atdrvvarrrgepvivapeevefmdvspkqvfslntnlipflehddanralmgsnmqtqa
vpliraqapvvmtgleervvrdslaalyaeedgevvkvdgtriavryedgrlvhplrrya
rsnqgtafdqrprvrvgqrvdlladgpaseegflalgqnvlvaimpfdgynfedaivise
ellkrdfytsihieryeieardtklgperitrdiphlseaalrdldeegivrigaevkpg
dilvgrtsfkgeqepspeerllrsifgekardvkdtslrvppgeggivvgrlrlrrgdpg
velkpgvrevvrvfvaqkrklqvgdklanrhgnkgvvakilpvedmphlpdgtpvdviln
plgvpsrmnlgqilethlglagyflgqryispvfdgatepeikellaeafnlyfgkrqge
gfgvdkrekevlaraeklglvspgkspeeqlkelfdlgkvvlydgrtgepfegpivvgqm
fimklyhmvedkmharstgpyslitqqplggkaqfggqrfgemevwaleaygaahtlqem
ltiksddiegrnaayqaiikgedvpepsvpesfrvlvkelqalaldvqtldekdnpvdif
egla

SCOPe Domain Coordinates for d1l9uc_:

Click to download the PDB-style file with coordinates for d1l9uc_.
(The format of our PDB-style files is described here.)

Timeline for d1l9uc_: