SCOP 1.61: Domain d1l9mb3: 1l9m B:594-692

Lineage for d1l9mb3 (1l9m B:594-692)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (1 family)

5. Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein)

6. Protein Transglutaminase, two C-terminal domains [49311] (4 species)

7. Species Human (Homo sapiens), TGase E3 [TaxId:9606] [74850] (2 PDB entries)

8. Domain d1l9mb3: 1l9m B:594-692 [73738]
   Other proteins in same PDB: d1l9ma1, d1l9ma4, d1l9mb1, d1l9mb4

Details for d1l9mb3

PDB Entry: 1l9m, 2.1 Å

PDB Description: three-dimensional structure of the human transglutaminase 3 enzyme: binding of calcium ions change structure for activation

SCOP Domain Sequences for d1l9mb3:

Sequence; same for both SEQRES and ATOM records:

>d1l9mb3 b.1.5.1 (B:594-692) Transglutaminase, two C-terminal domains {Human (Homo sapiens), TGase E3}
ptltlevlnearvrkpvnvqmlfsnpldepvrdcvlmvegsglllgnlkidvptlgpker
srvrfdilpsrsgtkqlladfscnkfpaikamlsidvae

Timeline for d1l9mb3:

• d1l9mb3 is new in SCOP 1.61
  
• d1l9mb3 appears in SCOP 1.63
  
• d1l9mb3 appears in the current release, SCOPe 2.08