Lineage for d1l9mb1 (1l9m B:1-140)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 291481Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 291761Family b.1.18.9: Transglutaminase N-terminal domain [81289] (1 protein)
  6. 291762Protein Transglutaminase N-terminal domain [49235] (4 species)
    elaborated with many loop insertions in the common fold
  7. 291778Species Human (Homo sapiens), TGase E3 [TaxId:9606] [74845] (5 PDB entries)
  8. 291782Domain d1l9mb1: 1l9m B:1-140 [73736]
    Other proteins in same PDB: d1l9ma2, d1l9ma3, d1l9ma4, d1l9mb2, d1l9mb3, d1l9mb4
    complexed with br, ca, cl; mutant

Details for d1l9mb1

PDB Entry: 1l9m (more details), 2.1 Å

PDB Description: three-dimensional structure of the human transglutaminase 3 enzyme: binding of calcium ions change structure for activation

SCOP Domain Sequences for d1l9mb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l9mb1 b.1.18.9 (B:1-140) Transglutaminase N-terminal domain {Human (Homo sapiens), TGase E3}
aalgvqsinwqtafnrqahhtdkfssqelilrrgqnfqvlmimnkglgsnerlefivstg
pypsesamtkavfplsngssggwsavlqasngntltisisspasapigrytmalqifsqg
gissvklgtfillfnpwlnv

SCOP Domain Coordinates for d1l9mb1:

Click to download the PDB-style file with coordinates for d1l9mb1.
(The format of our PDB-style files is described here.)

Timeline for d1l9mb1: