SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1l9ma1 (1l9m A:1-140)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2032114Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2032683Family b.1.18.9: Transglutaminase N-terminal domain [81289] (1 protein)
  6. 2032684Protein Transglutaminase N-terminal domain [49235] (4 species)
    elaborated with many loop insertions in the common fold
  7. 2032704Species Human (Homo sapiens), TGase E3 [TaxId:9606] [74845] (9 PDB entries)
  8. 2032715Domain d1l9ma1: 1l9m A:1-140 [73732]
    Other proteins in same PDB: d1l9ma2, d1l9ma3, d1l9ma4, d1l9mb2, d1l9mb3, d1l9mb4
    complexed with br, ca, cl

Details for d1l9ma1

PDB Entry: 1l9m (more details), 2.1 Å

PDB Description: Three-dimensional structure of the human transglutaminase 3 enzyme: binding of calcium ions change structure for activation
PDB Compounds: (A:) Protein-glutamine glutamyltransferase E3

SCOPe Domain Sequences for d1l9ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l9ma1 b.1.18.9 (A:1-140) Transglutaminase N-terminal domain {Human (Homo sapiens), TGase E3 [TaxId: 9606]}
aalgvqsinwqtafnrqahhtdkfssqelilrrgqnfqvlmimnkglgsnerlefivstg
pypsesamtkavfplsngssggwsavlqasngntltisisspasapigrytmalqifsqg
gissvklgtfillfnpwlnv

SCOPe Domain Coordinates for d1l9ma1:

Click to download the PDB-style file with coordinates for d1l9ma1.
(The format of our PDB-style files is described here.)

Timeline for d1l9ma1: