![]() | Class f: Membrane and cell surface proteins and peptides [56835] (36 folds) |
![]() | Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
![]() | Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) ![]() |
![]() | Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins) L and M are probably related to each other |
![]() | Protein L (light) subunit [81477] (3 species) |
![]() | Species Rhodobacter sphaeroides [TaxId:1063] [81475] (29 PDB entries) |
![]() | Domain d1l9jr_: 1l9j R: [73728] Other proteins in same PDB: d1l9jc_, d1l9jd_, d1l9jh1, d1l9jh2, d1l9jm_, d1l9js_, d1l9jt1, d1l9jt2 complexed with bcl, bph, cl, fe2, hem, lda, u10 |
PDB Entry: 1l9j (more details), 3.25 Å
SCOP Domain Sequences for d1l9jr_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l9jr_ f.26.1.1 (R:) L (light) subunit {Rhodobacter sphaeroides} allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging
Timeline for d1l9jr_: