Lineage for d1l9jm_ (1l9j M:)

  1. Root: SCOP 1.63
  2. 267451Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)
  3. 268375Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 268376Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
  5. 268377Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins)
    L and M are probably related to each other
  6. 268426Protein M (medium) subunit [81481] (3 species)
  7. 268427Species Rhodobacter sphaeroides [TaxId:1063] [81479] (29 PDB entries)
  8. 268457Domain d1l9jm_: 1l9j M: [73727]
    Other proteins in same PDB: d1l9jc_, d1l9jd_, d1l9jh1, d1l9jh2, d1l9jl_, d1l9jr_, d1l9jt1, d1l9jt2

Details for d1l9jm_

PDB Entry: 1l9j (more details), 3.25 Å

PDB Description: X-Ray Structure of the Cytochrome-c(2)-Photosynthetic Reaction Center Electron Transfer Complex from Rhodobacter sphaeroides in Type I Co-Crystals

SCOP Domain Sequences for d1l9jm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l9jm_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides}
fstllgwfgnaqlgpiylgslgvlslfsglmwfftigiwfwyqagwnpavflrdlfffsl
eppapeyglsfaaplkegglwliasffmfvavwswwgrtylraqalgmgkhtawaflsai
wlwmvlgfirpilmgswseavpygifshldwtnnfslvhgnlfynpfhglsiaflygsal
lfamhgatilavsrfggereleqiadrgtaaeraalfwrwtmgfnatmegihrwaiwmav
lvtltggigillsgtvvdnwyvwgqnh

SCOP Domain Coordinates for d1l9jm_:

Click to download the PDB-style file with coordinates for d1l9jm_.
(The format of our PDB-style files is described here.)

Timeline for d1l9jm_: