| Class f: Membrane and cell surface proteins and peptides [56835] (34 folds) |
| Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) ![]() |
| Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins) L and M are probably related to each other |
| Protein M (medium) subunit [81481] (3 species) |
| Species Rhodobacter sphaeroides [TaxId:1063] [81479] (29 PDB entries) |
| Domain d1l9jm_: 1l9j M: [73727] Other proteins in same PDB: d1l9jc_, d1l9jd_, d1l9jh1, d1l9jh2, d1l9jl_, d1l9jr_, d1l9jt1, d1l9jt2 |
PDB Entry: 1l9j (more details), 3.25 Å
SCOP Domain Sequences for d1l9jm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l9jm_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides}
fstllgwfgnaqlgpiylgslgvlslfsglmwfftigiwfwyqagwnpavflrdlfffsl
eppapeyglsfaaplkegglwliasffmfvavwswwgrtylraqalgmgkhtawaflsai
wlwmvlgfirpilmgswseavpygifshldwtnnfslvhgnlfynpfhglsiaflygsal
lfamhgatilavsrfggereleqiadrgtaaeraalfwrwtmgfnatmegihrwaiwmav
lvtltggigillsgtvvdnwyvwgqnh
Timeline for d1l9jm_: