Lineage for d1l9jm1 (1l9j M:)

  1. Root: SCOP 1.61
  2. 201426Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)
  3. 201495Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 201496Superfamily f.2.1: Membrane all-alpha [56869] (13 families) (S)
  5. 201555Family f.2.1.2: Photosynthetic reaction centre, L-, M- and H-chains [56878] (1 protein)
  6. 201556Protein Photosynthetic reaction centre, L-, M- and H-chains [56879] (3 species)
  7. 201557Species Rhodobacter sphaeroides [TaxId:1063] [56881] (28 PDB entries)
  8. 201644Domain d1l9jm1: 1l9j M: [73727]
    Other proteins in same PDB: d1l9jc_, d1l9jd_, d1l9jh1, d1l9jt1

Details for d1l9jm1

PDB Entry: 1l9j (more details), 3.25 Å

PDB Description: X-Ray Structure of the Cytochrome-c(2)-Photosynthetic Reaction Center Electron Transfer Complex from Rhodobacter sphaeroides in Type I Co-Crystals

SCOP Domain Sequences for d1l9jm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l9jm1 f.2.1.2 (M:) Photosynthetic reaction centre, L-, M- and H-chains {Rhodobacter sphaeroides}
fstllgwfgnaqlgpiylgslgvlslfsglmwfftigiwfwyqagwnpavflrdlfffsl
eppapeyglsfaaplkegglwliasffmfvavwswwgrtylraqalgmgkhtawaflsai
wlwmvlgfirpilmgswseavpygifshldwtnnfslvhgnlfynpfhglsiaflygsal
lfamhgatilavsrfggereleqiadrgtaaeraalfwrwtmgfnatmegihrwaiwmav
lvtltggigillsgtvvdnwyvwgqnh

SCOP Domain Coordinates for d1l9jm1:

Click to download the PDB-style file with coordinates for d1l9jm1.
(The format of our PDB-style files is described here.)

Timeline for d1l9jm1: